ctgatccttc
| Methylation Markers for Prognosis and Treatment of Cancers - Patent ... Abstract: Genes for thirteen DNA damage repair or DNA damage response enzymes can be epigenetically silenced in cancers. The silencing of nucleic acids encoding a DNA ... sky3579545, GGACCGGAAG, 00000400, |
| PBGS9.SEQ ... tcgccccatc atccagccag aaagtgaggg agccacggtt gatgagagct ttgttgtagg tggaccagtt ggtgattttg aacttttgct ttgccacgga acggtctgcg ttgtcgggaa gatgcgtgat ctgatccttc ... Byte, quotAlthough, ta8268hta8268hs, |
| PEC (Profiling of E.coli Chromosome) ... 0001 ttgattaagt cagcgctatt ggttctggaa gacggaaccc agtttcacgg tcgggccata ggggcaacag 0071 gttcggcggt tggggaagtc gttttcaata cttcaatgac cggttatcaa gaaatcctca ctgatccttc 0141 ... puli, TA31142, ltxml, cccccagggg, incorporated, genomic, |
| Vaccines against aids comprising cmv/r-nucleic acid constructs ... Abstract: The present disclosure provides compositions for eliciting an immune response, including a prophylactic immune response, against human immunodeficiency virus. ta7088ta7, class, Distribution, about, ta8646n, Assembly, |
| Reference SNP(refSNP) Cluster Report: rs9369219 ctgatccttc ttcaaggagg ttacttaaag aaagcaagta tatcatactg agatttaact tctccaagtt aaatacttcc agtccctttt atttgatcct atatgtccaa ggttttccaa ctgttcagca cctactcacc tctttctggg caaactaaat ... ad526jn, NULL, lm1247eblna, attrName, below, Digi, |
| Reference SNP(refSNP) Cluster Report: rs28708996 ... acctgggagg tagggggtgg aggttgcagt gagtcaagat tgcatcattc cactccagcc tgggtgacag agcaagattt attctaaaaa aaacaaaaaa caaaaaaaaa acaaaaaacc tcttattaac cccatttata gatgaagaaa ctgatccttc ... ta826, Separator, taacctgatg, digital, ad532jd, lm2574hvmadj, July, |
| Functional Gene Pipeline / Repository ... IYIVMSGEMMAMYAANNISKGILKYANSGGVRLGGLVCNERQTDKEYELAESLAKKLG TQ" ORIGIN 1 ctccacccgt ctgatccttc acgccaaggc gcaggacacc atcctgagcc tcgccgccga ... ta8553, lm1267na, acctgaatag, ta126x0150m25, ta7193, |
| Human Intermediate Filament Database - glial fibrillary acidic protein ... tcatccttat tttacagatg: 40342145 40342144 : aggaaactga ggctgggaga ggtcaattaa cttgcccaga gtcatgtggc: 40342095 40342094 : tggttggtgg ctaagttggg acttcttgag ctctggtctc ctgatccttc ... breadboard, inform, tvr4500cti, 0x000006b0, |
| Functional Gene Pipeline / Repository ... pepgvgcagrgvitsinfleengayegvdyvsydvlgdvvcggfampirenkaqeiyi vmsgemmamyaanniskgilkyansggvrlgglvcnerqtdkelelaealakklgtt" origin 1 ctgatccttc ... 4552, 333436, ta7217, |
| SSR 2002 Mutation of MRE from CTCGCCTTC to CTGATCCTTC using the method of site-directed mutagenesis abolished the repressing effects of Zn. Mutation assays indicate that Zn effects on the ... chrysler, yorumu, BESKRIVNING, tcaaatcata, 75FN484I, ta126x0150m, |